- FFAR4/GPR120 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89739
- PBS (pH 7.2) and 40% Glycerol
- FFAR4/GPR120
- Rabbit
- 0.1 ml (also 25ul)
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: FRVVPQRLPG ADQEISICTL IWPTIPGEIS WDV
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Human
- BMIQ10, GT01, O3FAR1, PGR4, GPR120, OB10Q, GPR129
- free fatty acid receptor 4
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- GPCR
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
FRVVPQRLPGADQEISICTLIWPTIPGEISWDV
Specifications/Features
Available conjugates: Unconjugated